Protein Info for b0513 in Escherichia coli BW25113

Name: ybbY
Annotation: putative transport (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 9 to 395 (387 residues), 335.9 bits, see alignment E=1.4e-104

Best Hits

Swiss-Prot: 100% identical to YBBY_ECOLI: Putative purine permease YbbY (ybbY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0513)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77328 at UniProt or InterPro

Protein Sequence (433 amino acids)

>b0513 putative transport (VIMSS) (Escherichia coli BW25113)
MFNFAVSRESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSLLTLTQYAFLATALACFA
QAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATSLAVGIALSGVLTMLIGFS
GLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGIADPNFKIQLPPFALSVAVM
CLVLAMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSLSGELHWQWFPLGSGGALSPG
IILTAVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRRSFVATGFMTLITVPLAVIPFS
PFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTRLFCSIPLPVSSAVMLVSYLPLL
FSALVFSQQITFTARNIYRLALPLFVGIFLMALPPVYLQDLPLTLRPLLSNGLLVGILLA
VLMDNLIPWERIE