Protein Info for b0511 in Escherichia coli BW25113

Name: ybbW
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 46 to 79 (34 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 451 to 468 (18 residues), see Phobius details TIGR00800: NCS1 nucleoside transporter family" amino acids 14 to 455 (442 residues), 460.5 bits, see alignment E=2.7e-142 PF02133: Transp_cyt_pur" amino acids 19 to 457 (439 residues), 472.5 bits, see alignment E=6.7e-146

Best Hits

Swiss-Prot: 100% identical to ALLP_ECOLI: Putative allantoin permease (ybbW) from Escherichia coli (strain K12)

KEGG orthology group: K10975, allantoin permease (inferred from 100% identity to eco:b0511)

MetaCyc: 100% identical to allantoin transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-444

Predicted SEED Role

"Allantoin permease" in subsystem Allantoin Utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75712 at UniProt or InterPro

Protein Sequence (484 amino acids)

>b0511 putative transport protein (VIMSS) (Escherichia coli BW25113)
MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPNYVMVGGFFILGLSTF
SIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGALFPGLLRGGIAAIMWF
GLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFLIFWLVNVGIGFGGGKVL
NKFTAILNPCIYIVFGGMAIWAISLVGIGPIFDYIPSGIQKAENGGFLFLVVINAVVAVW
AAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVCIIAGASIHYGADTWNVLDI
VQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAIAPTKLTYKNGVLIASIISLL
ICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVMRGQINLDELYTAPGDYKYYDN
GFNLTAFSVTLVAVILSLGGKFIHFMEPLSRVSWFVGVIVAFAAYALLKKRTTAEKTGEQ
KTIG