Protein Info for b0508 in Escherichia coli BW25113

Name: hyi
Annotation: hydroxypyruvate isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR03234: hydroxypyruvate isomerase" amino acids 3 to 255 (253 residues), 418 bits, see alignment E=6.2e-130 PF01261: AP_endonuc_2" amino acids 21 to 256 (236 residues), 167.4 bits, see alignment E=2.4e-53

Best Hits

Swiss-Prot: 100% identical to HYI_ECOLI: Hydroxypyruvate isomerase (hyi) from Escherichia coli (strain K12)

KEGG orthology group: K01816, hydroxypyruvate isomerase [EC: 5.3.1.22] (inferred from 100% identity to eco:b0508)

MetaCyc: 100% identical to hydroxypyruvate isomerase (Escherichia coli K-12 substr. MG1655)
Hydroxypyruvate isomerase. [EC: 5.3.1.22]

Predicted SEED Role

"Hydroxypyruvate isomerase (EC 5.3.1.22)" (EC 5.3.1.22)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.22

Use Curated BLAST to search for 5.3.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30147 at UniProt or InterPro

Protein Sequence (258 amino acids)

>b0508 hydroxypyruvate isomerase (NCBI) (Escherichia coli BW25113)
MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEELKHVLASNKLEHTLHN
LPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPAGFSSEQIHA
TLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALKLIDDVGCCNLKIQYDIY
HMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYDYLFKVIENSDYNGWVGCE
YKPQTTTEAGLRWMDPYR