Protein Info for b0479 in Escherichia coli BW25113

Name: fsr
Annotation: predicted fosmidomycin efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 261 (231 residues), 93 bits, see alignment E=9.4e-31 amino acids 232 to 405 (174 residues), 57.9 bits, see alignment E=4.4e-20

Best Hits

Swiss-Prot: 100% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 100% identity to eco:b0479)

MetaCyc: 100% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52067 at UniProt or InterPro

Protein Sequence (406 amino acids)

>b0479 predicted fosmidomycin efflux system (NCBI) (Escherichia coli BW25113)
MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLILAIYPLLQSEFSLTFM
QIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGLVLLALAGSFGAVLLAA
ALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSLGPLLAAVIIAPYGKGNV
AWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPRNKVVLAVSILLILIFSKY
FYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTVIGGPVGDKIGRKYVIWGSI
LGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYAQELLPGRIGMVSGLFFGFAF
GMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFLPDNRHKD