Protein Info for b0457 in Escherichia coli BW25113

Name: ylaB
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 28 (2 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details PF12792: CSS-motif" amino acids 38 to 242 (205 residues), 181.4 bits, see alignment E=1.5e-57 PF00563: EAL" amino acids 274 to 501 (228 residues), 222.9 bits, see alignment E=4.1e-70

Best Hits

Swiss-Prot: 100% identical to PDEB_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeB (pdeB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0457)

Predicted SEED Role

"Uncharacterized protein ylaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77473 at UniProt or InterPro

Protein Sequence (516 amino acids)

>b0457 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYSSRVAIRANKVATQGK
DALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVAYIDNNVPQCSSLEHESPPDTFPEP
GKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFIDVIPYSSWQIDAAIIGNA
HNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPLPEMNISIITWASTKMLQKGWH
RQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIENRDICVHYQPIVSLANGKIV
GAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIRSVFEDMGDWLRQHPQQHISI
NLESPVLTSEKIPQLLRDMINHYQVNPRQIALELTEREFADPKTSAPIISRYREAGHEIY
LDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVTPHIIEMAKTLKLKMVAEGIETS
KQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL