Protein Info for b0450 in Escherichia coli BW25113

Name: glnK
Annotation: nitrogen assimilation regulatory protein for GlnL, GlnE, and AmtB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF00543: P-II" amino acids 1 to 106 (106 residues), 110.7 bits, see alignment E=2.1e-36

Best Hits

Swiss-Prot: 100% identical to GLNK_SHIFL: Nitrogen regulatory protein P-II 2 (glnK) from Shigella flexneri

KEGG orthology group: K04752, nitrogen regulatory protein P-II 2 (inferred from 100% identity to eco:b0450)

MetaCyc: 100% identical to nitrogen regulatory protein PII-2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AC55 at UniProt or InterPro

Protein Sequence (112 amino acids)

>b0450 nitrogen assimilation regulatory protein for GlnL, GlnE, and AmtB (NCBI) (Escherichia coli BW25113)
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVK
IDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL