Protein Info for b0448 in Escherichia coli BW25113

Name: mdlA
Annotation: fused predicted multidrug transporter subunits of ABC superfamily: ATP-binding components (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 22 to 291 (270 residues), 126.6 bits, see alignment E=1.5e-40 PF00005: ABC_tran" amino acids 352 to 500 (149 residues), 107.3 bits, see alignment E=9.7e-35

Best Hits

Swiss-Prot: 100% identical to MDLA_ECOLI: Multidrug resistance-like ATP-binding protein MdlA (mdlA) from Escherichia coli (strain K12)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to eco:b0448)

Predicted SEED Role

"ATP-binding component of a transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77265 at UniProt or InterPro

Protein Sequence (590 amino acids)

>b0448 fused predicted multidrug transporter subunits of ABC superfamily: ATP-binding components (NCBI) (Escherichia coli BW25113)
MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDGVTEQHFTTGQILMWI
ATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQHPEFYLRHRTGDLMARA
TNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLFSLLPMPVMAIMIKRNGD
ALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSALFAADAEDTGKKNMRVARI
DARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFMMYLGLMIWPMLALAWMFNI
VERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIHQFTYPQTDHPALENVNFALK
PGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPF
LFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRLPQGYDTEVGERGVMLSGGQKQR
ISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQWGQGRTVIISAHRLSALTEASEI
IVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAALDDAPENREEAVDA