Protein Info for b0447 in Escherichia coli BW25113

Name: ybaO
Annotation: putative LRP-like transcriptional regulator (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13412: HTH_24" amino acids 2 to 48 (47 residues), 62.2 bits, see alignment E=4.1e-21 PF13404: HTH_AsnC-type" amino acids 2 to 43 (42 residues), 60.2 bits, see alignment E=2.1e-20 PF01037: AsnC_trans_reg" amino acids 65 to 148 (84 residues), 93.3 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 100% identical to DECR_ECOLI: DNA-binding transcriptional activator DecR (decR) from Escherichia coli (strain K12)

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 100% identity to eco:b0447)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ybaO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACJ5 at UniProt or InterPro

Protein Sequence (152 amino acids)

>b0447 putative LRP-like transcriptional regulator (VIMSS) (Escherichia coli BW25113)
MLDKIDRKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDDGILIGKVALLDPEKI
GLGLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYDYLMRVQVADMKRYDEF
YKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE