Protein Info for b0438 in Escherichia coli BW25113

Name: clpX
Annotation: ATP-dependent protease ATP-binding subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 5 to 412 (408 residues), 719.1 bits, see alignment E=8.3e-221 PF06689: zf-C4_ClpX" amino acids 14 to 50 (37 residues), 72.5 bits, see alignment 8e-24 PF00493: MCM" amino acids 69 to 193 (125 residues), 25.3 bits, see alignment E=3.2e-09 PF01078: Mg_chelatase" amino acids 110 to 146 (37 residues), 21.6 bits, see alignment 5.2e-08 PF07724: AAA_2" amino acids 112 to 310 (199 residues), 116.7 bits, see alignment E=4.6e-37 PF07728: AAA_5" amino acids 114 to 191 (78 residues), 26.1 bits, see alignment E=3.1e-09 PF00004: AAA" amino acids 115 to 220 (106 residues), 57.7 bits, see alignment E=7.3e-19 PF10431: ClpB_D2-small" amino acids 317 to 395 (79 residues), 50 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 100% identical to CLPX_ECO27: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to eco:b0438)

MetaCyc: 100% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A6H1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>b0438 ATP-dependent protease ATP-binding subunit (NCBI) (Escherichia coli BW25113)
MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEIKEVAPHRE
RSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGP
TGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGI
VYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQEFLQVDT
SKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKASEGELLAQVEPEDLIKFGL
IPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAK
KAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSKPLLIYGKPEAQQ
ASGE