Protein Info for b0436 in Escherichia coli BW25113

Name: tig
Annotation: trigger factor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF05697: Trigger_N" amino acids 1 to 144 (144 residues), 151.6 bits, see alignment E=2.9e-48 TIGR00115: trigger factor" amino acids 13 to 412 (400 residues), 477 bits, see alignment E=2.4e-147 PF00254: FKBP_C" amino acids 158 to 237 (80 residues), 65.2 bits, see alignment E=8.3e-22 PF05698: Trigger_C" amino acids 262 to 412 (151 residues), 142.3 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 100% identical to TIG_ECO81: Trigger factor (tig) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to eco:b0436)

MetaCyc: 100% identical to trigger factor (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A850 at UniProt or InterPro

Protein Sequence (432 amino acids)

>b0436 trigger factor (NCBI) (Escherichia coli BW25113)
MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA
SVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGL
EAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGG
KASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKV
EERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDI
DVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQAKRRVVVGLLLGEVIRTNEL
KADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMRNVALEEQAVEAVLAKAKVTEK
ETTFNELMNQQA