Protein Info for b0431 in Escherichia coli BW25113

Name: cyoB
Annotation: cytochrome o ubiquinol oxidase subunit I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details amino acids 494 to 518 (25 residues), see Phobius details amino acids 593 to 626 (34 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 2 to 647 (646 residues), 1201.4 bits, see alignment E=0 PF00115: COX1" amino acids 56 to 504 (449 residues), 485.4 bits, see alignment E=8.4e-150

Best Hits

Swiss-Prot: 100% identical to CYOB_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to ecg:E2348C_0366)

MetaCyc: 100% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABI8 at UniProt or InterPro

Protein Sequence (663 amino acids)

>b0431 cytochrome o ubiquinol oxidase subunit I (NCBI) (Escherichia coli BW25113)
MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIM
YIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVI
GLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLSGIE
YSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLII
ASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSE
IAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTG
VKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLHNSLFLIAHF
HNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMT
RRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLE
WATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFST
IFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAGLK
NGN