Protein Info for b0429 in Escherichia coli BW25113

Name: cyoD
Annotation: cytochrome o ubiquinol oxidase subunit IV (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 12 to 107 (96 residues), 127.6 bits, see alignment E=1e-41 PF03626: COX4_pro" amino acids 20 to 92 (73 residues), 65.3 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 100% identical to CYOD_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Escherichia coli (strain K12)

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 100% identity to eco:b0429)

MetaCyc: 100% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABJ6 at UniProt or InterPro

Protein Sequence (109 amino acids)

>b0429 cytochrome o ubiquinol oxidase subunit IV (NCBI) (Escherichia coli BW25113)
MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV
HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH