Protein Info for b0423 in Escherichia coli BW25113

Name: thiI
Annotation: thiamine biosynthesis protein ThiI (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 377 (374 residues), 488.3 bits, see alignment E=1.6e-150 PF02926: THUMP" amino acids 28 to 162 (135 residues), 111.9 bits, see alignment E=2.9e-36 PF02568: ThiI" amino acids 175 to 369 (195 residues), 274.6 bits, see alignment E=4.4e-86 TIGR04271: thiazole biosynthesis domain" amino acids 383 to 482 (100 residues), 135.3 bits, see alignment E=6.6e-44

Best Hits

Swiss-Prot: 100% identical to THII_ECOBW: tRNA sulfurtransferase (thiI) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 100% identity to eco:b0423)

MetaCyc: 100% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77718 at UniProt or InterPro

Protein Sequence (482 amino acids)

>b0423 thiamine biosynthesis protein ThiI (NCBI) (Escherichia coli BW25113)
MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR
LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFS
SIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV
LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV
AINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN
LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAVKSKI
EAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVETVNGFGPNDVILDIRSIDEQE
DKPLKVEGIDVVSLPFYKLSTKFGDLDQNKTWLLWCERGVMSRLQALYLREQGFNNVKVY
RP