Protein Info for b0421 in Escherichia coli BW25113
Name: ispA
Annotation: geranyltranstransferase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ISPA_ECOLI: Farnesyl diphosphate synthase (ispA) from Escherichia coli (strain K12)
KEGG orthology group: K00795, farnesyl diphosphate synthase [EC: 2.5.1.1 2.5.1.10] (inferred from 100% identity to eco:b0421)MetaCyc: 100% identical to geranyl diphosphate/farnesyl diphosphate synthase (Escherichia coli K-12 substr. MG1655)
Geranyltranstransferase. [EC: 2.5.1.10]; Dimethylallyltranstransferase. [EC: 2.5.1.10, 2.5.1.1]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
- taxadiene biosynthesis (engineered) (11/13 steps found)
- polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
- trans, trans-farnesyl diphosphate biosynthesis (2/2 steps found)
- geranyl diphosphate biosynthesis (1/1 steps found)
- all-trans-farnesol biosynthesis (3/4 steps found)
- (3R)-linalool biosynthesis (1/2 steps found)
- (3S)-linalool biosynthesis (1/2 steps found)
- linalool biosynthesis I (1/2 steps found)
- superpathway of linalool biosynthesis (1/3 steps found)
- bisabolene biosynthesis (engineered) (3/6 steps found)
- mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
- ipsdienol biosynthesis (1/4 steps found)
- methyl phomopsenoate biosynthesis (1/4 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
- stellatic acid biosynthesis (2/8 steps found)
- viridicatumtoxin biosynthesis (1/9 steps found)
- superpathway of ergosterol biosynthesis II (11/26 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
- superpathway of ergosterol biosynthesis I (4/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
- superpathway of cholesterol biosynthesis (4/38 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.5.1.1 or 2.5.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P22939 at UniProt or InterPro
Protein Sequence (299 amino acids)
>b0421 geranyltranstransferase (NCBI) (Escherichia coli BW25113) MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFG VSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTL AFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRH KTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQG ADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK