Protein Info for b0407 in Escherichia coli BW25113

Name: yajC
Annotation: preprotein translocase subunit YajC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00739: preprotein translocase, YajC subunit
  • amino acids 19 to 102 (84 residues), 118.2 bits, E=6.6e-39
• PF02699: YajC
  • amino acids 22 to 99 (78 residues), 90.9 bits, E=1.9e-30

Best Hits

Swiss-Prot: 100% identical to YAJC_SHIFL: Sec translocon accessory complex subunit YajC (yajC) from Shigella flexneri

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to eco:b0407)

MetaCyc: 100% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

See P0ADZ7 at UniProt or InterPro

Protein Sequence (110 amino acids)

>b0407 preprotein translocase subunit YajC (NCBI) (Escherichia coli BW25113)
MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD
EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL