Protein Info for b0404 in Escherichia coli BW25113

Name: yajB
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04336: ACP_PD
  • amino acids 81 to 186 (106 residues), 95.5 bits, E=1.2e-31

Best Hits

Swiss-Prot: 100% identical to ACPH_ECOSM: Acyl carrier protein phosphodiesterase (acpH) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K08682, acyl carrier protein phosphodiesterase [EC: 3.1.4.14] (inferred from 100% identity to eco:b0404)

MetaCyc: 100% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

• acyl carrier protein metabolism (2/2 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

See P21515 at UniProt or InterPro

Protein Sequence (193 amino acids)

>b0404 hypothetical protein (NCBI) (Escherichia coli BW25113)
MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMHRRIDVLTDNLPEVRE
AREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRF
INLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSWYDLDAHYDALETRFWQF
YPRMMAQASRKAL