Protein Info for b0356 in Escherichia coli BW25113

Name: frmA
Annotation: alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  • amino acids 2 to 369 (368 residues), 741.9 bits, E=6.3e-228
• PF08240: ADH_N
  • amino acids 28 to 153 (126 residues), 91.6 bits, E=2.8e-30
• PF00107: ADH_zinc_N
  • amino acids 197 to 327 (131 residues), 76.3 bits, E=2.2e-25

Best Hits

Swiss-Prot: 100% identical to FRMA_ECOLI: S-(hydroxymethyl)glutathione dehydrogenase (frmA) from Escherichia coli (strain K12)

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 100% identity to eco:b0356)

MetaCyc: 100% identical to S-(hydroxymethyl)glutathione dehydrogenase (Escherichia coli K-12 substr. MG1655)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• ethanolamine utilization (5/5 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• protein S-nitrosylation and denitrosylation (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Methane metabolism
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

See P25437 at UniProt or InterPro

Protein Sequence (369 amino acids)

>b0356 alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase (NCBI) (Escherichia coli BW25113)
MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPVVL
GHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETQGKGLMPD
GTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPKKFDLARRFGATDCINPND
YDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAVAGQEISTRP
FQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEG
KSIRTVIRY