Protein Info for b0351 in Escherichia coli BW25113

Name: mhpF
Annotation: acetaldehyde dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR03215: acetaldehyde dehydrogenase (acetylating)" amino acids 3 to 308 (306 residues), 471.3 bits, see alignment E=5.2e-146 PF01118: Semialdhyde_dh" amino acids 5 to 119 (115 residues), 49.8 bits, see alignment E=4.6e-17 PF09290: AcetDehyd-dimer" amino acids 131 to 284 (154 residues), 206.3 bits, see alignment E=2.1e-65

Best Hits

Swiss-Prot: 100% identical to ACDH_ECO55: Acetaldehyde dehydrogenase (mhpF) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 100% identity to eco:b0351)

MetaCyc: 100% identical to acetaldehyde dehydrogenase (acetylating) MhpF (Escherichia coli K-12 substr. MG1655)
Acetaldehyde dehydrogenase (acetylating). [EC: 1.2.1.10]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.10

Use Curated BLAST to search for 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77580 at UniProt or InterPro

Protein Sequence (316 amino acids)

>b0351 acetaldehyde dehydrogenase (NCBI) (Escherichia coli BW25113)
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA