Protein Info for b0350 in Escherichia coli BW25113

Name: mhpD
Annotation: 2-keto-4-pentenoate hydratase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 57 to 259 (203 residues), 103.7 bits, E=6.1e-34

Best Hits

Swiss-Prot: 100% identical to MHPD_ECOLI: 2-keto-4-pentenoate hydratase (mhpD) from Escherichia coli (strain K12)

KEGG orthology group: K02554, 2-keto-4-pentenoate hydratase [EC: 4.2.1.80] (inferred from 100% identity to eco:b0350)

MetaCyc: 100% identical to 2-hydroxypentadienoate hydratase (Escherichia coli K-12 substr. MG1655)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• catechol degradation I (meta-cleavage pathway) (3/5 steps found)
• catechol degradation II (meta-cleavage pathway) (3/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (3/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (3/7 steps found)
• p-cumate degradation (3/8 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (1/6 steps found)
• meta cleavage pathway of aromatic compounds (3/10 steps found)
• p-cymene degradation (3/11 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• L-tryptophan degradation IX (3/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (3/12 steps found)
• naphthalene degradation to acetyl-CoA (3/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
• mandelate degradation to acetyl-CoA (4/18 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.80

Sequence Analysis Tools

See P77608 at UniProt or InterPro

Protein Sequence (269 amino acids)

>b0350 2-keto-4-pentenoate hydratase (VIMSS) (Escherichia coli BW25113)
MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHINVQHDVAQGRRVVGRK
VGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRIEAEIALVLNRDLPATD
ITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGVYVIGGPAQRPAGLDLKN
CAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPLRTGDIILTGALGPMVAVN
AGDRFEAHIEGIGSVAATFSSAAPKGSLS