Protein Info for b0349 in Escherichia coli BW25113

Name: mhpC
Annotation: 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF12146: Hydrolase_4" amino acids 40 to 272 (233 residues), 46.6 bits, see alignment E=4.4e-16 PF00561: Abhydrolase_1" amino acids 42 to 279 (238 residues), 89.4 bits, see alignment E=4.6e-29 PF12697: Abhydrolase_6" amino acids 43 to 284 (242 residues), 88.5 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 100% identical to MHPC_ECOLI: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase (mhpC) from Escherichia coli (strain K12)

KEGG orthology group: K05714, 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [EC: 3.7.1.-] (inferred from 100% identity to eco:b0349)

MetaCyc: 100% identical to 2-hydroxy-6-ketonona-2,4-dienedioate hydrolase (Escherichia coli K-12 substr. MG1655)
MHPCHYDROL-RXN [EC: 3.7.1.14]; 3.7.1.14 [EC: 3.7.1.14]

Predicted SEED Role

"2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase (EC 3.7.1.-)" in subsystem Cinnamic Acid Degradation (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77044 at UniProt or InterPro

Protein Sequence (293 amino acids)

>b0349 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase (VIMSS) (Escherichia coli BW25113)
MQEKMMSYQPQTEAATSRFLNVEEAGKTLRIHFNDCGQGDETVVLLHGSGPGATGWANFS
RNIDPLVEAGYRVILLDCPGWGKSDSVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSM
GGHSSVAFTLKWPERVGKLVLMGGGTGGMSLFTPMPTEGIKRLNQLYRQPTIENLKLMMD
IFVFDTSDLTDALFEARLNNMLSRRDHLENFVKSLEANPKQFPDFGPRLAEIKAQTLIVW
GRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADAFNQLVLNFLARP