Protein Info for b0348 in Escherichia coli BW25113

Name: mhpB
Annotation: 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to MHPB_ECO7I: 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K05713, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase [EC: 1.13.11.16] (inferred from 100% identity to eco:b0348)

MetaCyc: 100% identical to 3-carboxyethylcatechol 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
3-carboxyethylcatechol 2,3-dioxygenase. [EC: 1.13.11.16]; 1.13.11.16 [EC: 1.13.11.16]

Predicted SEED Role

No annotation

MetaCyc Pathways

3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (5/5 steps found)
cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (5/5 steps found)

KEGG Metabolic Maps

Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABR9 at UniProt or InterPro

Protein Sequence (314 amino acids)

>b0348 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (NCBI) (Escherichia coli BW25113)
MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPELVVLFAPDHYNGFFYD
VMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGIDLAVSYCMQVDHGFAQP
LEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTSTLNKRVLFLGSGGLSHQ
PPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEKFVEDQRTLHPLNPIWDNQ
FMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAAISAFGNWRSEGRYYRPIPE
WIAGFGSLSARTEN