Protein Info for b0318 in Escherichia coli BW25113

Name: yahD
Annotation: predicted transcriptional regulator with ankyrin domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF12796: Ank_2" amino acids 12 to 69 (58 residues), 34.6 bits, see alignment E=6e-12 amino acids 78 to 174 (97 residues), 45 bits, see alignment E=3.3e-15 PF13637: Ank_4" amino acids 13 to 59 (47 residues), 32.8 bits, see alignment 1.7e-11 PF00023: Ank" amino acids 39 to 69 (31 residues), 21.4 bits, see alignment 6e-08 amino acids 112 to 136 (25 residues), 15.7 bits, see alignment (E = 4e-06) amino acids 139 to 175 (37 residues), 21 bits, see alignment 8e-08

Best Hits

Swiss-Prot: 100% identical to YAHD_ECOLI: Putative ankyrin repeat protein YahD (yahD) from Escherichia coli (strain K12)

KEGG orthology group: K06867, (no description) (inferred from 100% identity to eco:b0318)

Predicted SEED Role

"Putative transcription factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77736 at UniProt or InterPro

Protein Sequence (201 amino acids)

>b0318 predicted transcriptional regulator with ankyrin domain (NCBI) (Escherichia coli BW25113)
MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITLASLYQQYACVQALID
AGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRFGGVGLTPACEKGHLSI
VKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLLLEHGASPHLTDKYGKTP
LELARERGFEEIAQLLIAAGA