Protein Info for b0317 in Escherichia coli BW25113

Name: yahC
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 49 (17 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details PF06496: DUF1097" amino acids 9 to 152 (144 residues), 95.5 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 100% identical to YAHC_ECOLI: Uncharacterized protein YahC (yahC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0317)

Predicted SEED Role

"FIG00638603: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77219 at UniProt or InterPro

Protein Sequence (165 amino acids)

>b0317 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSFYAAGGGKSGFIRSLA
VNYSGMVWAFFAALTAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWLLSFIPGGFLG
MTLFFASGMNWTVTLLGFLAGNCVGVISEYGGQKLSEATTKRDGY