Protein Info for b0305 in Escherichia coli BW25113

Name: ykgD
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF12852: Cupin_6" amino acids 2 to 162 (161 residues), 65.6 bits, see alignment E=7.7e-22 PF12833: HTH_18" amino acids 199 to 278 (80 residues), 80.5 bits, see alignment E=1.4e-26 PF00165: HTH_AraC" amino acids 244 to 276 (33 residues), 30.4 bits, see alignment 5.1e-11

Best Hits

Swiss-Prot: 100% identical to RCLR_ECOLI: RCS-specific HTH-type transcriptional activator RclR (rclR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0305)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ykgD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77379 at UniProt or InterPro

Protein Sequence (284 amino acids)

>b0305 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALTQGAAKLEMPTGEIFT
LRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTSLPETLFLAPVNHSVEY
NWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQVNTEKNILSLLLHPRLG
AVIQQMLEMPGHAWTVESLASIAHMSRASFAQLFRDVSGTTPLAVLTKLRLQIAAQMFSR
ETLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQLAP