Protein Info for b0272 in Escherichia coli BW25113

Name: yagI
Annotation: CP4-6 prophage; predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF09339: HTH_IclR" amino acids 6 to 57 (52 residues), 59.8 bits, see alignment E=1.8e-20 PF01614: IclR_C" amino acids 74 to 246 (173 residues), 220.1 bits, see alignment E=1.6e-69

Best Hits

Swiss-Prot: 100% identical to XYNR_ECOLI: HTH-type transcriptional regulator XynR (xynR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0272)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77300 at UniProt or InterPro

Protein Sequence (252 amino acids)

>b0272 CP4-6 prophage; predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MPIIQSVERALQILDLFNEQATELKITDISKLMGLSKSTLHSLLKTLQLHGYIDQNPENG
KYRLGMKLVERGHFVVGSIDIRQKAKGWLTELSRRTGQTTHLGILDGREGVYIEKIEGKL
AAIAYSRIGRRLPVHATAIGKVLIAWLGEAELNALLEGYQYTTFTPATLASREALMSALA
QTREQGYALDSEENEQGVRCVAVPVWNHESRVIAALSLSTLTSRVDDAELANFREQLQQA
GLALSRALGYPA