Protein Info for b0271 in Escherichia coli BW25113

Name: yagH
Annotation: CP4-6 prophage; predicted xylosidase/arabinosidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF04616: Glyco_hydro_43" amino acids 3 to 303 (301 residues), 347.8 bits, see alignment E=7.8e-108 PF17851: GH43_C2" amino acids 332 to 534 (203 residues), 233.5 bits, see alignment E=3.1e-73 PF07081: DUF1349" amino acids 390 to 535 (146 residues), 38.7 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 100% identical to YAGH_ECOLI: Putative beta-xylosidase (yagH) from Escherichia coli (strain K12)

KEGG orthology group: K01198, xylan 1,4-beta-xylosidase [EC: 3.2.1.37] (inferred from 100% identity to eco:b0271)

Predicted SEED Role

"Beta-xylosidase (EC 3.2.1.37)" in subsystem Xylose utilization (EC 3.2.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77713 at UniProt or InterPro

Protein Sequence (536 amino acids)

>b0271 CP4-6 prophage; predicted xylosidase/arabinosidase (NCBI) (Escherichia coli BW25113)
MEITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRDLKNWSLVSTPLDRVSM
LDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGRNFLVTAPSIEGPWSEPIP
MGNGGFDPSLFHDDDGRKYYIYRPWGPRHHSNPHNTIVLQAFDPQTGTLSPERKTLFTGT
PLCYTEGAHLYRHAGWYYLMAAEGGTSYEHAVVVLRSKNIDGPYELHPDVTMMTSWHLPE
NPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPLLASGGRGYCPLGRETGIARIEWRD
GWPYVEGGKHAQLTVKGPQVAEQPAAVPGNWRDDFDASSLDPELQTLRIPFDDTLGSLTA
RPGFLRLYGNDSLNSTFTQSTVARRWQHFAFRAETRMEFSPVHFQQSAGLTCYYNSKNWS
YCFVDYEEGQGRTIKVIQLDHNVPSWPLHEQPIPVPEHAESVWLRVDVDTLVYRYSYSFD
GETWHTVPVTYEAWKLSDDYIGGRGFFTGAFVGLHCEDISGDGCYADFDYFTYEPV