Protein Info for b0234 in Escherichia coli BW25113

Name: yafP
Annotation: predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13673: Acetyltransf_10" amino acids 31 to 142 (112 residues), 72.9 bits, see alignment E=4.9e-24 PF00583: Acetyltransf_1" amino acids 32 to 124 (93 residues), 35.3 bits, see alignment E=2.6e-12 PF13508: Acetyltransf_7" amino acids 55 to 125 (71 residues), 45.9 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 100% identical to YAFP_ECOLI: Uncharacterized N-acetyltransferase YafP (yafP) from Escherichia coli (strain K12)

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b0234)

Predicted SEED Role

"Uncharacterized acetyltransferase YafP (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47158 at UniProt or InterPro

Protein Sequence (150 amino acids)

>b0234 predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI) (Escherichia coli BW25113)
MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQIDESRWKEKLAKSQVWV
AIINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSESELTVDASITAKPFFE
RYGFQTVKQQRVECRGAWFTNFYMRYKPQH