Protein Info for b0227 in Escherichia coli BW25113

Name: yafL
Annotation: predicted lipoprotein and C40 family peptidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF00877: NLPC_P60" amino acids 131 to 241 (111 residues), 114 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 100% identical to YAFL_ECOLI: Probable endopeptidase YafL (yafL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0227)

Predicted SEED Role

"Hypothetical lipoprotein yafL precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47151 at UniProt or InterPro

Protein Sequence (249 amino acids)

>b0227 predicted lipoprotein and C40 family peptidase (NCBI) (Escherichia coli BW25113)
MSLPSIPSFVLSGLLLICLPFSSFASATTSHISFSYAARQRMQNRARLLKQYQTHLKKQA
SYIVEGNAESKRALRQHNREQIKQHPEWFPAPLKASDRRWQALAENNHFLSSDHLHNITE
VAIHRLEQQLGKPYVWGGTRPDKGFDCSGLVFYAYNKILEAKLPRTANEMYHYRRATIVA
NNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIESPRTGETIRISRLAEPFWQDHFLGAR
RILTEETIL