Protein Info for b0220 in Escherichia coli BW25113

Name: ivy
Annotation: inhibitor of vertebrate C-lysozyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF08816: Ivy" amino acids 39 to 152 (114 residues), 117.1 bits, see alignment E=2.6e-38

Best Hits

Swiss-Prot: 100% identical to IVY_ECO57: Inhibitor of vertebrate lysozyme (ivy) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0220)

Predicted SEED Role

"Inhibitor of vertebrate lysozyme precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AD59 at UniProt or InterPro

Protein Sequence (157 amino acids)

>b0220 inhibitor of vertebrate C-lysozyme (NCBI) (Escherichia coli BW25113)
MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKAAFNQMVQGHKLPAWV
MKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTIDEKTSQE
KLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK