Protein Info for b0210 in Escherichia coli BW25113

Name: yafE
Annotation: predicted S-adenosyl-L-methionine-dependent methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF08241: Methyltransf_11" amino acids 4 to 96 (93 residues), 82.7 bits, see alignment E=7.6e-27 PF13649: Methyltransf_25" amino acids 6 to 92 (87 residues), 66.5 bits, see alignment E=8.8e-22 PF08242: Methyltransf_12" amino acids 7 to 94 (88 residues), 45 bits, see alignment E=4.5e-15 PF13847: Methyltransf_31" amino acids 7 to 100 (94 residues), 56.9 bits, see alignment E=6.4e-19 PF01209: Ubie_methyltran" amino acids 15 to 103 (89 residues), 53 bits, see alignment E=9.2e-18 PF13489: Methyltransf_23" amino acids 17 to 139 (123 residues), 44.2 bits, see alignment E=5.2e-15

Best Hits

Swiss-Prot: 100% identical to YAFE_ECOLI: Uncharacterized protein YafE (yafE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0210)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30866 at UniProt or InterPro

Protein Sequence (207 amino acids)

>b0210 predicted S-adenosyl-L-methionine-dependent methyltransferase (NCBI) (Escherichia coli BW25113)
MSGLPQGRPTFGAAQNVSAVVAYDLSAHMLDVVAQAAEARQLKNITTRQGYAESLPFADN
AFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTVEALRDT
SHVRNYASGEWLTLINEANLIVDNLITDKLPLEFSSWVARMRTPEALVDAIRIYQQSAST
EVRTYFALQNDGFFTSDIIMVDAHKAA