Protein Info for b0200 in Escherichia coli BW25113

Name: gmhB
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 6 to 153 (148 residues), 128.4 bits, see alignment E=3.1e-41 TIGR00213: D,D-heptose 1,7-bisphosphate phosphatase" amino acids 6 to 181 (176 residues), 336.8 bits, see alignment E=3.7e-105 TIGR01662: HAD hydrolase, family IIIA" amino acids 7 to 155 (149 residues), 129.6 bits, see alignment E=1.3e-41 PF08645: PNK3P" amino acids 11 to 137 (127 residues), 31.2 bits, see alignment E=3.6e-11 PF00702: Hydrolase" amino acids 24 to 148 (125 residues), 37 bits, see alignment E=1e-12 PF13242: Hydrolase_like" amino acids 109 to 179 (71 residues), 48.3 bits, see alignment E=1.5e-16 PF13419: HAD_2" amino acids 110 to 150 (41 residues), 26.8 bits, see alignment 9.7e-10

Best Hits

Swiss-Prot: 100% identical to GMHBB_ECO57: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Escherichia coli O157:H7

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to eco:b0200)

MetaCyc: 100% identical to D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-4361 [EC: 3.1.3.82]

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P63228 at UniProt or InterPro

Protein Sequence (191 amino acids)

>b0200 hypothetical protein (NCBI) (Escherichia coli BW25113)
MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIAR
GKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSA
RDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLP
QAIKKQQKPAQ