Protein Info for b0196 in Escherichia coli BW25113

Name: rcsF
Annotation: predicted outer membrane protein, signal (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16358: RcsF" amino acids 26 to 132 (107 residues), 173.8 bits, see alignment E=4.6e-56

Best Hits

Swiss-Prot: 100% identical to RCSF_ECOL6: Outer membrane lipoprotein RcsF (rcsF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06080, RcsF protein (inferred from 100% identity to eco:b0196)

Predicted SEED Role

"Protein RcsF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69411 at UniProt or InterPro

Protein Sequence (134 amino acids)

>b0196 predicted outer membrane protein, signal (NCBI) (Escherichia coli BW25113)
MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVG
KPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYR
QAVCIGSALNITAK