Protein Info for b0192 in Escherichia coli BW25113

Name: nlpE
Annotation: lipoprotein involved with copper homeostasis and adhesion (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF04170: NlpE" amino acids 45 to 129 (85 residues), 96.4 bits, see alignment E=1.5e-31 PF17185: NlpE_C" amino acids 144 to 232 (89 residues), 107.2 bits, see alignment E=4.4e-35

Best Hits

Swiss-Prot: 100% identical to NLPE_ECOLI: Lipoprotein NlpE (nlpE) from Escherichia coli (strain K12)

KEGG orthology group: K06079, copper homeostasis protein (lipoprotein) (inferred from 100% identity to eco:b0192)

Predicted SEED Role

"Copper homeostasis protein CutF precursor / Lipoprotein NlpE involeved in surface adhesion" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P40710 at UniProt or InterPro

Protein Sequence (236 amino acids)

>b0192 lipoprotein involved with copper homeostasis and adhesion (NCBI) (Escherichia coli BW25113)
MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRGVLPCADCEGIETS
LFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSKGEKSYYRAKGDALEML
DREGNPIESQFNYTLEAAQSSLPMTPMTLRGMYFYMADAATFTDCATGKRFMVANNAELE
RSYLAARGHSEKPVLLSVEGHFTLEGNPDTGAPTKVLAPDTAGKFYPNQDCSSLGQ