Protein Info for b0163 in Escherichia coli BW25113

Name: yaeH
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF11944: DUF3461" amino acids 1 to 125 (125 residues), 186.3 bits, see alignment E=1.1e-59

Best Hits

Swiss-Prot: 100% identical to YAEH_ECODH: UPF0325 protein YaeH (yaeH) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: None (inferred from 100% identity to eco:b0163)

Predicted SEED Role

"UPF0325 protein YaeH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62768 at UniProt or InterPro

Protein Sequence (128 amino acids)

>b0163 hypothetical protein (NCBI) (Escherichia coli BW25113)
MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKSVKFKYPRQRKTVVAD
GVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDLRHLESVVTNKISEIEA
DLEKLTRK