Protein Info for b0160 in Escherichia coli BW25113

Name: dgt
Annotation: deoxyguanosinetriphosphate triphosphohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 TIGR01353: putative dGTPase" amino acids 30 to 502 (473 residues), 498.7 bits, see alignment E=8.3e-154 PF01966: HD" amino acids 66 to 146 (81 residues), 31.5 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 100% identical to DGTP_ECOLI: Deoxyguanosinetriphosphate triphosphohydrolase (dgt) from Escherichia coli (strain K12)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to eco:b0160)

MetaCyc: 100% identical to dGTP triphosphohydrolase (Escherichia coli K-12 substr. MG1655)
dGTPase. [EC: 3.1.5.1]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P15723 at UniProt or InterPro

Protein Sequence (505 amino acids)

>b0160 deoxyguanosinetriphosphate triphosphohydrolase (NCBI) (Escherichia coli BW25113)
MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAIRRLQQKTQVFPLERN
AAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIG
NPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAALRLRDGEEPLNELRRKIRQDL
CHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEE
AYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAVEKRIFTVEQLYHHLHEAWG
QHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIF
AGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSL
SLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSKLPSDSPEFPLWEYYYRCRL
LQDYISGMTDLYAWDEYRRLMAVEQ