Protein Info for b0143 in Escherichia coli BW25113

Name: pcnB
Annotation: poly(A) polymerase I (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR01942: poly(A) polymerase" amino acids 31 to 458 (428 residues), 522.8 bits, see alignment E=3.2e-161 PF01743: PolyA_pol" amino acids 62 to 193 (132 residues), 139.7 bits, see alignment E=9.9e-45 PF12627: PolyA_pol_RNAbd" amino acids 220 to 281 (62 residues), 72.9 bits, see alignment E=2.2e-24 PF12626: PolyA_pol_arg_C" amino acids 338 to 457 (120 residues), 137.4 bits, see alignment E=3.6e-44

Best Hits

Swiss-Prot: 100% identical to PCNB_ECO57: Poly(A) polymerase I (pcnB) from Escherichia coli O157:H7

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to eco:b0143)

MetaCyc: 100% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABF1 at UniProt or InterPro

Protein Sequence (465 amino acids)

>b0143 poly(A) polymerase I (VIMSS) (Escherichia coli BW25113)
MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLNKAGY
EAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV
ATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDY
VGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLND
IPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLK
NTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSL
AIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEVERNAELQRLV
KWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA