Protein Info for b0133 in Escherichia coli BW25113

Name: panC
Annotation: pantoate--beta-alanine ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 281 (281 residues), 438.8 bits, see alignment E=6.5e-136 PF02569: Pantoate_ligase" amino acids 3 to 278 (276 residues), 356.9 bits, see alignment E=2.9e-111 TIGR00125: cytidyltransferase-like domain" amino acids 23 to 68 (46 residues), 29.9 bits, see alignment 5e-11

Best Hits

Swiss-Prot: 100% identical to PANC_ECOLI: Pantothenate synthetase (panC) from Escherichia coli (strain K12)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to eco:b0133)

MetaCyc: 100% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31663 at UniProt or InterPro

Protein Sequence (283 amino acids)

>b0133 pantoate--beta-alanine ligase (NCBI) (Escherichia coli BW25113)
MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAKARADVVVVSIFVNPM
QFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTETHTYVDVPGLSTMLEG
ASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRA
KDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDLDEIITIAGQELNEKGFRA
DDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVELA