Protein Info for b0132 in Escherichia coli BW25113

Name: yadD
Annotation: predicted transposase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF04754: Transposase_31" amino acids 7 to 208 (202 residues), 295.8 bits, see alignment E=7.6e-93 TIGR01784: conserved hypothetical protein" amino acids 8 to 296 (289 residues), 298.3 bits, see alignment E=3.7e-93

Best Hits

Swiss-Prot: 100% identical to RPNC_ECOLI: Recombination-promoting nuclease RpnC (rpnC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0132)

MetaCyc: 53% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"Transposase ECs0136"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31665 at UniProt or InterPro

Protein Sequence (300 amino acids)

>b0132 predicted transposase (NCBI) (Escherichia coli BW25113)
MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLHLESGSFIEESLKGHS
TDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHRHLEADHDKLPLVVPIL
FYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPDDEIMQHRRIAILELLQK
HIRQRDLMLLLEQLVTLIDEGYTSGSQLVAMQNYMLQRGHTEQADLFYGVLRDRETGGES
MMTLAQWFEEKGIEKGIQQGRQEVSQEFAQRLLSKGMSREDVAEMANLPLAEIDKVINLI