Protein Info for b0111 in Escherichia coli BW25113

Name: ampE
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF17113: AmpE" amino acids 1 to 284 (284 residues), 531.2 bits, see alignment E=3.3e-164

Best Hits

Swiss-Prot: 100% identical to AMPE_ECOLI: Protein AmpE (ampE) from Escherichia coli (strain K12)

KEGG orthology group: K03807, AmpE protein (inferred from 100% identity to eco:b0111)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE14 at UniProt or InterPro

Protein Sequence (284 amino acids)

>b0111 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLGMTIIAMGVTFLLLRA
LQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVP
AGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLMGYAFLRAWQYWLARYQT
PHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWFASLGDFHTSQYQVLTRLA
QFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYGALV