Protein Info for b0094 in Escherichia coli BW25113

Name: ftsA
Annotation: cell division protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR01174: cell division protein FtsA" amino acids 9 to 385 (377 residues), 535.9 bits, see alignment E=2.6e-165 PF02491: SHS2_FTSA" amino acids 85 to 162 (78 residues), 102 bits, see alignment E=3.7e-33 PF06723: MreB_Mbl" amino acids 203 to 359 (157 residues), 38.4 bits, see alignment E=1.4e-13 PF14450: FtsA" amino acids 207 to 381 (175 residues), 132.5 bits, see alignment E=2.5e-42

Best Hits

Swiss-Prot: 100% identical to FTSA_ECOLI: Cell division protein FtsA (ftsA) from Escherichia coli (strain K12)

KEGG orthology group: K03590, cell division protein FtsA (inferred from 100% identity to eco:b0094)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABH0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>b0094 cell division protein (NCBI) (Escherichia coli BW25113)
MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF