Protein Info for b0089 in Escherichia coli BW25113

Name: ftsW
Annotation: integral membrane protein involved in stabilizing FstZ ring during cell division (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 45 to 400 (356 residues), 446.5 bits, see alignment E=3.5e-138 PF01098: FTSW_RODA_SPOVE" amino acids 47 to 402 (356 residues), 450.6 bits, see alignment E=1.9e-139

Best Hits

Swiss-Prot: 100% identical to FTSW_ECOLI: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Escherichia coli (strain K12)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 100% identity to eco:b0089)

MetaCyc: 100% identical to peptidoglycan glycosyltransferase FtsW (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABG4 at UniProt or InterPro

Protein Sequence (414 amino acids)

>b0089 integral membrane protein involved in stabilizing FstZ ring during cell division (NCBI) (Escherichia coli BW25113)
MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGF
IMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPMEFWQRYSATMLLGSII
LLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKGDEVRNNLRGFLK
PMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAE
PYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIF
AIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNV
GAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDYETRLEKAQAFVRGSR