Protein Info for b0083 in Escherichia coli BW25113

Name: ftsL
Annotation: membrane bound cell division protein at septum containing leucine zipper motif (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details PF04999: FtsL" amino acids 25 to 119 (95 residues), 132.3 bits, see alignment E=2.7e-43 TIGR02209: cell division protein FtsL" amino acids 36 to 118 (83 residues), 96.9 bits, see alignment E=2.5e-32

Best Hits

Swiss-Prot: 100% identical to FTSL_ECOL6: Cell division protein FtsL (ftsL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 100% identity to eco:b0083)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEN4 at UniProt or InterPro

Protein Sequence (121 amino acids)

>b0083 membrane bound cell division protein at septum containing leucine zipper motif (NCBI) (Escherichia coli BW25113)
MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHT
RLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
K