Protein Info for b0082 in Escherichia coli BW25113

Name: mraW
Annotation: S-adenosyl-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 1 to 310 (310 residues), 452.3 bits, see alignment E=4.9e-140 PF01795: Methyltransf_5" amino acids 5 to 310 (306 residues), 413.6 bits, see alignment E=3.2e-128

Best Hits

Swiss-Prot: 100% identical to RSMH_SHIB3: Ribosomal RNA small subunit methyltransferase H (rsmH) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to eco:b0082)

MetaCyc: 100% identical to 16S rRNA m4C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11638 [EC: 2.1.1.199]

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.199

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60390 at UniProt or InterPro

Protein Sequence (313 amino acids)

>b0082 S-adenosyl-methyltransferase (NCBI) (Escherichia coli BW25113)
MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQA
IAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGVSSPQLDDAERGFSFMR
DGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKRIARAIVERNREQPMTRT
KELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIIS
FHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQLRALGKLMPGEEEVAENPRA
RSSVLRIAERTNA