Protein Info for b0076 in Escherichia coli BW25113

Name: leuO
Annotation: probable transcriptional activator for leuABCD operon (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00126: HTH_1" amino acids 24 to 81 (58 residues), 64.7 bits, see alignment E=6e-22 PF03466: LysR_substrate" amino acids 129 to 309 (181 residues), 63.6 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 100% identical to LEUO_ECOLI: HTH-type transcriptional regulator LeuO (leuO) from Escherichia coli (strain K12)

KEGG orthology group: K05798, LysR family transcriptional regulator, transcriptional activator for leuABCD operon (inferred from 100% identity to eco:b0076)

Predicted SEED Role

"Probable transcriptional activator for leuABCD operon" in subsystem Leucine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P10151 at UniProt or InterPro

Protein Sequence (314 amino acids)

>b0076 probable transcriptional activator for leuABCD operon (VIMSS) (Escherichia coli BW25113)
MPEVQTDHPETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHVLGMSQPAVSNAVARL
KVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSGFEPASSERVFHLCVCS
PLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETEFVISYEDFHRPEFTSVP
LFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASFSQPWYDTVDKQASIAYQG
MAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLKQNSRTCYLSWHEAAGRDKG
HQWMEEQLVSICKR