Protein Info for b0071 in Escherichia coli BW25113

Name: leuD
Annotation: isopropylmalate isomerase small subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 3 to 189 (187 residues), 343.8 bits, see alignment E=1.3e-107 PF00694: Aconitase_C" amino acids 3 to 126 (124 residues), 144.2 bits, see alignment E=4.4e-46 PF27512: LeuD" amino acids 130 to 166 (37 residues), 46.2 bits, see alignment 4.7e-16 PF27434: LeuD_C" amino acids 179 to 198 (20 residues), 35.2 bits, see alignment (E = 1e-12)

Best Hits

Swiss-Prot: 100% identical to LEUD_ECO8A: 3-isopropylmalate dehydratase small subunit (leuD) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 100% identity to eco:b0071)

MetaCyc: 100% identical to 3-isopropylmalate dehydratase subunit LeuD (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydratase. [EC: 4.2.1.33]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30126 at UniProt or InterPro

Protein Sequence (201 amino acids)

>b0071 isopropylmalate isomerase small subunit (NCBI) (Escherichia coli BW25113)
MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPD
FVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLL
PVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFTIDAFRRHCMMNGLDSIG
LTLQHDDAIAAYEAKQPAFMN