Protein Info for b0047 in Escherichia coli BW25113

Name: kefC
Annotation: glutathione-regulated potassium-efflux system protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 285 (272 residues), 315 bits, see alignment E=2.4e-98 PF00999: Na_H_Exchanger" amino acids 16 to 374 (359 residues), 197.2 bits, see alignment E=5.9e-62 PF02254: TrkA_N" amino acids 402 to 512 (111 residues), 98 bits, see alignment E=6.9e-32 PF27452: KefB_C" amino acids 521 to 591 (71 residues), 68.8 bits, see alignment E=6.1e-23

Best Hits

Swiss-Prot: 100% identical to KEFC_ECOLC: Glutathione-regulated potassium-efflux system protein KefC (kefC) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K11745, glutathione-regulated potassium-efflux system ancillary protein KefC (inferred from 100% identity to eco:b0047)

MetaCyc: 100% identical to K+ : H+ antiporter KefC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-42

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefC" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P03819 at UniProt or InterPro

Protein Sequence (620 amino acids)

>b0047 glutathione-regulated potassium-efflux system protein (NCBI) (Escherichia coli BW25113)
MDSHTLIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWGLRLVTDAESILHFAE
IGVVLMLFIIGLELDPQRLWKLRAAVFGCGALQMVICGGLLGLFCMLLGLRWQVAELIGM
TLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLVAMIPLLATSSASTTMGA
FALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAVALFLVFGFGLLLEEVGLS
MAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLLENPLRIVILL
LGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAFVVFGAAQMANVLEPEWAKSL
TLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQPRVIIAGFGRFGQITGRLLLS
SGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQL
TEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGALKTGRLALESLGLGPYEA
RERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTSAMLSEIITEDREHLSLIQRHGWQG
TEEGKHTGNMADEPETKPSS