Protein Info for b0045 in Escherichia coli BW25113

Name: yaaU
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 386 (359 residues), 128.7 bits, see alignment E=2.6e-41 PF00083: Sugar_tr" amino acids 53 to 434 (382 residues), 179.8 bits, see alignment E=9.2e-57

Best Hits

Swiss-Prot: 100% identical to YAAU_ECOLI: Putative metabolite transport protein YaaU (yaaU) from Escherichia coli (strain K12)

KEGG orthology group: K08368, MFS transporter, putative metabolite transport protein (inferred from 100% identity to eco:b0045)

Predicted SEED Role

"Putative metabolite transport protein yaaU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31679 at UniProt or InterPro

Protein Sequence (443 amino acids)

>b0045 predicted transporter (NCBI) (Escherichia coli BW25113)
MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLTPALKLDADWIGLLGA
GTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVSSPVELLVMRVLIGIVI
GADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGYWLYDVEGGWRWMLGSAA
IPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVAFDEEQPQQTRFRDLFNRR
HFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNAALGNVVISLFFMLGCIPPM
LWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMAFAVYAFFSGGPGNLQWLYPN
ELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGISNTMLMGAGISLFGLLISVAF
APETRGMSLAQTSNMTIRGQRMG