Protein Info for b0021 in Escherichia coli BW25113

Name: insB-1
Annotation: IS1 transposase InsAB' (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF03400: DDE_Tnp_IS1" amino acids 37 to 167 (131 residues), 259.7 bits, see alignment E=2.9e-82

Best Hits

Swiss-Prot: 100% identical to INSB1_ECOLI: Insertion element IS1 1 protein InsB (insB1) from Escherichia coli (strain K12)

KEGG orthology group: K07480, insertion element IS1 protein InsB (inferred from 100% identity to eco:b0021)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CF29 at UniProt or InterPro

Protein Sequence (167 amino acids)

>b0021 IS1 transposase InsAB' (NCBI) (Escherichia coli BW25113)
MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
YAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKR
YTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ