Protein Info for b0016 in Escherichia coli BW25113

Name: insL-1
Annotation: IS186/IS421 transposase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF01609: DDE_Tnp_1" amino acids 107 to 348 (242 residues), 92.6 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 100% identical to INSL3_ECOLI: Putative transposase InsL for insertion sequence element IS186C (insL3) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2394)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CF91 at UniProt or InterPro

Protein Sequence (370 amino acids)

>b0016 IS186/IS421 transposase (NCBI) (Escherichia coli BW25113)
MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLRLGLAYGPGGMSLREV
TAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTGCTSGKRLRLVDGTAIS
APGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECI
RSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGA
PFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQ
VADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFLIDDIIQPSLDFP
PRSAGSEKKN