Protein Info for b0007 in Escherichia coli BW25113

Name: yaaJ
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 342 to 370 (29 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 441 (429 residues), 556.5 bits, see alignment E=1.9e-171 PF01235: Na_Ala_symp" amino acids 50 to 453 (404 residues), 498 bits, see alignment E=1.2e-153

Best Hits

Swiss-Prot: 100% identical to YAAJ_ECOLI: Uncharacterized transporter YaaJ (yaaJ) from Escherichia coli (strain K12)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to eco:b0007)

Predicted SEED Role

"Putative alanine/glycine transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30143 at UniProt or InterPro

Protein Sequence (476 amino acids)

>b0007 predicted transporter (NCBI) (Escherichia coli BW25113)
MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGKSLKNSIHPQPGGLTS
FQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMATSFAECSLAQLYKERD
VNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQANAVARALSFSFDFPPLV
TGIILAVFTLLAITRGLHGVARLMQGFVPLMAIIWVLTSLVICVMNIGQLPHVIWSIFES
AFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNAAAAAASWPPHPAAQGIVQM
IGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAMRVLMGSWGAEFVTLVVILFA
FSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIGGTLLSLPLMWQLADIIMACMA
ITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRYPDIGRQLSPDAWDDVSQE